PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003148m
Common NameCARUB_v10003148mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 342aa    MW: 38321.9 Da    PI: 6.0951
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003148mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ede+lv++v+++G  +W++ ++  g++R++k+c++rw +yl
  Carubv10003148m 14 KGPWTPDEDEKLVNYVQEHGHSSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.84.6e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr++++E++ +++++  lG++ W+tIa+ ++ gRt++++k++w+++l
  Carubv10003148m  67 RGRFSPDEEQTILNLHSVLGNK-WSTIANQLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-24664IPR009057Homeodomain-like
PROSITE profilePS5129418.088961IPR017930Myb domain
SuperFamilySSF466893.47E-3111108IPR009057Homeodomain-like
SMARTSM007175.0E-151363IPR001005SANT/Myb domain
PfamPF002491.5E-171461IPR001005SANT/Myb domain
CDDcd001674.91E-121661No hitNo description
PROSITE profilePS5129426.03162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2765117IPR009057Homeodomain-like
SMARTSM007174.3E-1566114IPR001005SANT/Myb domain
PfamPF002494.5E-1567112IPR001005SANT/Myb domain
CDDcd001673.73E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRPPSSDDS GLKKGPWTPD EDEKLVNYVQ EHGHSSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGRF SPDEEQTILN LHSVLGNKWS TIANQLPGRT DNEIKNFWNT HLKKKLIQMG  120
IDPMTHRPRT DIFSGLSQLM SMSSNLRGFA ELQQQFPISQ EHTILRLQTE MAKLQLFQYL  180
LQPSSFMNTI NPNDLDSLSL LNSIASFKET TTTTTSNTLD LGCLGSYLQD FNSLPSLKTL  240
NSNSMEPSSV FPQNPDDNHF KFFTQRQNLP VSPIWLSDPS SSTQSLTLPN SVVTDDLIRN  300
QYGVEDVNSN ITSSSCQESA ASASAAWPDH LLDDSIFSDI P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00503DAPTransfer from AT5G10280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196190.0AY519619.1 Arabidopsis thaliana MYB transcription factor (At5g10280) mRNA, complete cds.
GenBankBT0028770.0BT002877.1 Arabidopsis thaliana clone RAFL14-88-D17 (R20400) putative myb family transcription factor (At5g10280) mRNA, complete cds.
GenBankBT0044020.0BT004402.1 Arabidopsis thaliana clone U20400 putative myb family transcription factor (At5g10280) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289596.10.0hypothetical protein CARUB_v10003148mg
SwissprotQ8GWP02e-71MYB39_ARATH; Transcription factor MYB39
TrEMBLR0GZZ00.0R0GZZ0_9BRAS; Uncharacterized protein
STRINGAT5G10280.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.10.0myb domain protein 92